mirror of
https://github.com/superseriousbusiness/gotosocial.git
synced 2025-10-29 06:42:25 -05:00
[chore]: Bump github.com/minio/minio-go/v7 from 7.0.60 to 7.0.61 (#2041)
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
This commit is contained in:
parent
b874e9251e
commit
9ed9d96597
34 changed files with 510 additions and 748 deletions
5
vendor/github.com/klauspost/compress/flate/deflate.go
generated
vendored
5
vendor/github.com/klauspost/compress/flate/deflate.go
generated
vendored
|
|
@ -90,9 +90,8 @@ type advancedState struct {
|
|||
ii uint16 // position of last match, intended to overflow to reset.
|
||||
|
||||
// input window: unprocessed data is window[index:windowEnd]
|
||||
index int
|
||||
estBitsPerByte int
|
||||
hashMatch [maxMatchLength + minMatchLength]uint32
|
||||
index int
|
||||
hashMatch [maxMatchLength + minMatchLength]uint32
|
||||
|
||||
// Input hash chains
|
||||
// hashHead[hashValue] contains the largest inputIndex with the specified hash value
|
||||
|
|
|
|||
5
vendor/github.com/klauspost/compress/flate/huffman_bit_writer.go
generated
vendored
5
vendor/github.com/klauspost/compress/flate/huffman_bit_writer.go
generated
vendored
|
|
@ -34,11 +34,6 @@ const (
|
|||
// Should preferably be a multiple of 6, since
|
||||
// we accumulate 6 bytes between writes to the buffer.
|
||||
bufferFlushSize = 246
|
||||
|
||||
// bufferSize is the actual output byte buffer size.
|
||||
// It must have additional headroom for a flush
|
||||
// which can contain up to 8 bytes.
|
||||
bufferSize = bufferFlushSize + 8
|
||||
)
|
||||
|
||||
// Minimum length code that emits bits.
|
||||
|
|
|
|||
19
vendor/github.com/klauspost/compress/flate/huffman_sortByFreq.go
generated
vendored
19
vendor/github.com/klauspost/compress/flate/huffman_sortByFreq.go
generated
vendored
|
|
@ -42,25 +42,6 @@ func quickSortByFreq(data []literalNode, a, b, maxDepth int) {
|
|||
}
|
||||
}
|
||||
|
||||
// siftDownByFreq implements the heap property on data[lo, hi).
|
||||
// first is an offset into the array where the root of the heap lies.
|
||||
func siftDownByFreq(data []literalNode, lo, hi, first int) {
|
||||
root := lo
|
||||
for {
|
||||
child := 2*root + 1
|
||||
if child >= hi {
|
||||
break
|
||||
}
|
||||
if child+1 < hi && (data[first+child].freq == data[first+child+1].freq && data[first+child].literal < data[first+child+1].literal || data[first+child].freq < data[first+child+1].freq) {
|
||||
child++
|
||||
}
|
||||
if data[first+root].freq == data[first+child].freq && data[first+root].literal > data[first+child].literal || data[first+root].freq > data[first+child].freq {
|
||||
return
|
||||
}
|
||||
data[first+root], data[first+child] = data[first+child], data[first+root]
|
||||
root = child
|
||||
}
|
||||
}
|
||||
func doPivotByFreq(data []literalNode, lo, hi int) (midlo, midhi int) {
|
||||
m := int(uint(lo+hi) >> 1) // Written like this to avoid integer overflow.
|
||||
if hi-lo > 40 {
|
||||
|
|
|
|||
1
vendor/github.com/klauspost/compress/s2/encode_all.go
generated
vendored
1
vendor/github.com/klauspost/compress/s2/encode_all.go
generated
vendored
|
|
@ -742,7 +742,6 @@ searchDict:
|
|||
x := load64(src, s-2)
|
||||
m2Hash := hash6(x, tableBits)
|
||||
currHash := hash6(x>>8, tableBits)
|
||||
candidate = int(table[currHash])
|
||||
table[m2Hash] = uint32(s - 2)
|
||||
table[currHash] = uint32(s - 1)
|
||||
cv = load64(src, s)
|
||||
|
|
|
|||
44
vendor/github.com/klauspost/compress/s2/encode_better.go
generated
vendored
44
vendor/github.com/klauspost/compress/s2/encode_better.go
generated
vendored
|
|
@ -157,7 +157,6 @@ func encodeBlockBetterGo(dst, src []byte) (d int) {
|
|||
index0 := base + 1
|
||||
index1 := s - 2
|
||||
|
||||
cv = load64(src, s)
|
||||
for index0 < index1 {
|
||||
cv0 := load64(src, index0)
|
||||
cv1 := load64(src, index1)
|
||||
|
|
@ -269,18 +268,21 @@ func encodeBlockBetterGo(dst, src []byte) (d int) {
|
|||
lTable[hash7(cv0, lTableBits)] = uint32(index0)
|
||||
sTable[hash4(cv0>>8, sTableBits)] = uint32(index0 + 1)
|
||||
|
||||
// lTable could be postponed, but very minor difference.
|
||||
lTable[hash7(cv1, lTableBits)] = uint32(index1)
|
||||
sTable[hash4(cv1>>8, sTableBits)] = uint32(index1 + 1)
|
||||
index0 += 1
|
||||
index1 -= 1
|
||||
cv = load64(src, s)
|
||||
|
||||
// index every second long in between.
|
||||
for index0 < index1 {
|
||||
// Index large values sparsely in between.
|
||||
// We do two starting from different offsets for speed.
|
||||
index2 := (index0 + index1 + 1) >> 1
|
||||
for index2 < index1 {
|
||||
lTable[hash7(load64(src, index0), lTableBits)] = uint32(index0)
|
||||
lTable[hash7(load64(src, index1), lTableBits)] = uint32(index1)
|
||||
lTable[hash7(load64(src, index2), lTableBits)] = uint32(index2)
|
||||
index0 += 2
|
||||
index1 -= 2
|
||||
index2 += 2
|
||||
}
|
||||
}
|
||||
|
||||
|
|
@ -459,12 +461,14 @@ func encodeBlockBetterSnappyGo(dst, src []byte) (d int) {
|
|||
index1 -= 1
|
||||
cv = load64(src, s)
|
||||
|
||||
// index every second long in between.
|
||||
for index0 < index1 {
|
||||
// Index large values sparsely in between.
|
||||
// We do two starting from different offsets for speed.
|
||||
index2 := (index0 + index1 + 1) >> 1
|
||||
for index2 < index1 {
|
||||
lTable[hash7(load64(src, index0), lTableBits)] = uint32(index0)
|
||||
lTable[hash7(load64(src, index1), lTableBits)] = uint32(index1)
|
||||
lTable[hash7(load64(src, index2), lTableBits)] = uint32(index2)
|
||||
index0 += 2
|
||||
index1 -= 2
|
||||
index2 += 2
|
||||
}
|
||||
}
|
||||
|
||||
|
|
@ -599,7 +603,6 @@ searchDict:
|
|||
if s >= sLimit {
|
||||
break searchDict
|
||||
}
|
||||
cv = load64(src, s)
|
||||
// Index in-between
|
||||
index0 := base + 1
|
||||
index1 := s - 2
|
||||
|
|
@ -865,12 +868,14 @@ searchDict:
|
|||
index1 -= 1
|
||||
cv = load64(src, s)
|
||||
|
||||
// index every second long in between.
|
||||
for index0 < index1 {
|
||||
// Index large values sparsely in between.
|
||||
// We do two starting from different offsets for speed.
|
||||
index2 := (index0 + index1 + 1) >> 1
|
||||
for index2 < index1 {
|
||||
lTable[hash7(load64(src, index0), lTableBits)] = uint32(index0)
|
||||
lTable[hash7(load64(src, index1), lTableBits)] = uint32(index1)
|
||||
lTable[hash7(load64(src, index2), lTableBits)] = uint32(index2)
|
||||
index0 += 2
|
||||
index1 -= 2
|
||||
index2 += 2
|
||||
}
|
||||
}
|
||||
|
||||
|
|
@ -961,7 +966,6 @@ searchDict:
|
|||
index0 := base + 1
|
||||
index1 := s - 2
|
||||
|
||||
cv = load64(src, s)
|
||||
for index0 < index1 {
|
||||
cv0 := load64(src, index0)
|
||||
cv1 := load64(src, index1)
|
||||
|
|
@ -1079,12 +1083,14 @@ searchDict:
|
|||
index1 -= 1
|
||||
cv = load64(src, s)
|
||||
|
||||
// index every second long in between.
|
||||
for index0 < index1 {
|
||||
// Index large values sparsely in between.
|
||||
// We do two starting from different offsets for speed.
|
||||
index2 := (index0 + index1 + 1) >> 1
|
||||
for index2 < index1 {
|
||||
lTable[hash7(load64(src, index0), lTableBits)] = uint32(index0)
|
||||
lTable[hash7(load64(src, index1), lTableBits)] = uint32(index1)
|
||||
lTable[hash7(load64(src, index2), lTableBits)] = uint32(index2)
|
||||
index0 += 2
|
||||
index1 -= 2
|
||||
index2 += 2
|
||||
}
|
||||
}
|
||||
|
||||
|
|
|
|||
655
vendor/github.com/klauspost/compress/s2/encodeblock_amd64.s
generated
vendored
655
vendor/github.com/klauspost/compress/s2/encodeblock_amd64.s
generated
vendored
File diff suppressed because it is too large
Load diff
7
vendor/github.com/klauspost/compress/s2/reader.go
generated
vendored
7
vendor/github.com/klauspost/compress/s2/reader.go
generated
vendored
|
|
@ -147,6 +147,13 @@ type Reader struct {
|
|||
ignoreCRC bool
|
||||
}
|
||||
|
||||
// GetBufferCapacity returns the capacity of the internal buffer.
|
||||
// This might be useful to know when reusing the same reader in combination
|
||||
// with the lazy buffer option.
|
||||
func (r *Reader) GetBufferCapacity() int {
|
||||
return cap(r.buf)
|
||||
}
|
||||
|
||||
// ensureBufferSize will ensure that the buffer can take at least n bytes.
|
||||
// If false is returned the buffer exceeds maximum allowed size.
|
||||
func (r *Reader) ensureBufferSize(n int) bool {
|
||||
|
|
|
|||
2
vendor/github.com/klauspost/compress/s2/writer.go
generated
vendored
2
vendor/github.com/klauspost/compress/s2/writer.go
generated
vendored
|
|
@ -771,7 +771,7 @@ func (w *Writer) closeIndex(idx bool) ([]byte, error) {
|
|||
}
|
||||
|
||||
var index []byte
|
||||
if w.err(nil) == nil && w.writer != nil {
|
||||
if w.err(err) == nil && w.writer != nil {
|
||||
// Create index.
|
||||
if idx {
|
||||
compSize := int64(-1)
|
||||
|
|
|
|||
1
vendor/github.com/klauspost/cpuid/v2/README.md
generated
vendored
1
vendor/github.com/klauspost/cpuid/v2/README.md
generated
vendored
|
|
@ -435,6 +435,7 @@ Exit Code 1
|
|||
| SYSCALL | System-Call Extension (SCE): SYSCALL and SYSRET instructions. |
|
||||
| SYSEE | SYSENTER and SYSEXIT instructions |
|
||||
| TBM | AMD Trailing Bit Manipulation |
|
||||
| TDX_GUEST | Intel Trust Domain Extensions Guest |
|
||||
| TLB_FLUSH_NESTED | AMD: Flushing includes all the nested translations for guest translations |
|
||||
| TME | Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. |
|
||||
| TOPEXT | TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. |
|
||||
|
|
|
|||
20
vendor/github.com/klauspost/cpuid/v2/cpuid.go
generated
vendored
20
vendor/github.com/klauspost/cpuid/v2/cpuid.go
generated
vendored
|
|
@ -226,6 +226,7 @@ const (
|
|||
SYSCALL // System-Call Extension (SCE): SYSCALL and SYSRET instructions.
|
||||
SYSEE // SYSENTER and SYSEXIT instructions
|
||||
TBM // AMD Trailing Bit Manipulation
|
||||
TDX_GUEST // Intel Trust Domain Extensions Guest
|
||||
TLB_FLUSH_NESTED // AMD: Flushing includes all the nested translations for guest translations
|
||||
TME // Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE.
|
||||
TOPEXT // TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX.
|
||||
|
|
@ -1186,13 +1187,8 @@ func support() flagSet {
|
|||
fs.setIf(edx&(1<<30) != 0, IA32_CORE_CAP)
|
||||
fs.setIf(edx&(1<<31) != 0, SPEC_CTRL_SSBD)
|
||||
|
||||
// CPUID.(EAX=7, ECX=1).EDX
|
||||
fs.setIf(edx&(1<<4) != 0, AVXVNNIINT8)
|
||||
fs.setIf(edx&(1<<5) != 0, AVXNECONVERT)
|
||||
fs.setIf(edx&(1<<14) != 0, PREFETCHI)
|
||||
|
||||
// CPUID.(EAX=7, ECX=1).EAX
|
||||
eax1, _, _, _ := cpuidex(7, 1)
|
||||
eax1, _, _, edx1 := cpuidex(7, 1)
|
||||
fs.setIf(fs.inSet(AVX) && eax1&(1<<4) != 0, AVXVNNI)
|
||||
fs.setIf(eax1&(1<<7) != 0, CMPCCXADD)
|
||||
fs.setIf(eax1&(1<<10) != 0, MOVSB_ZL)
|
||||
|
|
@ -1202,6 +1198,11 @@ func support() flagSet {
|
|||
fs.setIf(eax1&(1<<23) != 0, AVXIFMA)
|
||||
fs.setIf(eax1&(1<<26) != 0, LAM)
|
||||
|
||||
// CPUID.(EAX=7, ECX=1).EDX
|
||||
fs.setIf(edx1&(1<<4) != 0, AVXVNNIINT8)
|
||||
fs.setIf(edx1&(1<<5) != 0, AVXNECONVERT)
|
||||
fs.setIf(edx1&(1<<14) != 0, PREFETCHI)
|
||||
|
||||
// Only detect AVX-512 features if XGETBV is supported
|
||||
if c&((1<<26)|(1<<27)) == (1<<26)|(1<<27) {
|
||||
// Check for OS support
|
||||
|
|
@ -1393,6 +1394,13 @@ func support() flagSet {
|
|||
fs.setIf((a>>24)&1 == 1, VMSA_REGPROT)
|
||||
}
|
||||
|
||||
if mfi >= 0x21 {
|
||||
// Intel Trusted Domain Extensions Guests have their own cpuid leaf (0x21).
|
||||
_, ebx, ecx, edx := cpuid(0x21)
|
||||
identity := string(valAsString(ebx, edx, ecx))
|
||||
fs.setIf(identity == "IntelTDX ", TDX_GUEST)
|
||||
}
|
||||
|
||||
return fs
|
||||
}
|
||||
|
||||
|
|
|
|||
99
vendor/github.com/klauspost/cpuid/v2/featureid_string.go
generated
vendored
99
vendor/github.com/klauspost/cpuid/v2/featureid_string.go
generated
vendored
|
|
@ -166,59 +166,60 @@ func _() {
|
|||
_ = x[SYSCALL-156]
|
||||
_ = x[SYSEE-157]
|
||||
_ = x[TBM-158]
|
||||
_ = x[TLB_FLUSH_NESTED-159]
|
||||
_ = x[TME-160]
|
||||
_ = x[TOPEXT-161]
|
||||
_ = x[TSCRATEMSR-162]
|
||||
_ = x[TSXLDTRK-163]
|
||||
_ = x[VAES-164]
|
||||
_ = x[VMCBCLEAN-165]
|
||||
_ = x[VMPL-166]
|
||||
_ = x[VMSA_REGPROT-167]
|
||||
_ = x[VMX-168]
|
||||
_ = x[VPCLMULQDQ-169]
|
||||
_ = x[VTE-170]
|
||||
_ = x[WAITPKG-171]
|
||||
_ = x[WBNOINVD-172]
|
||||
_ = x[WRMSRNS-173]
|
||||
_ = x[X87-174]
|
||||
_ = x[XGETBV1-175]
|
||||
_ = x[XOP-176]
|
||||
_ = x[XSAVE-177]
|
||||
_ = x[XSAVEC-178]
|
||||
_ = x[XSAVEOPT-179]
|
||||
_ = x[XSAVES-180]
|
||||
_ = x[AESARM-181]
|
||||
_ = x[ARMCPUID-182]
|
||||
_ = x[ASIMD-183]
|
||||
_ = x[ASIMDDP-184]
|
||||
_ = x[ASIMDHP-185]
|
||||
_ = x[ASIMDRDM-186]
|
||||
_ = x[ATOMICS-187]
|
||||
_ = x[CRC32-188]
|
||||
_ = x[DCPOP-189]
|
||||
_ = x[EVTSTRM-190]
|
||||
_ = x[FCMA-191]
|
||||
_ = x[FP-192]
|
||||
_ = x[FPHP-193]
|
||||
_ = x[GPA-194]
|
||||
_ = x[JSCVT-195]
|
||||
_ = x[LRCPC-196]
|
||||
_ = x[PMULL-197]
|
||||
_ = x[SHA1-198]
|
||||
_ = x[SHA2-199]
|
||||
_ = x[SHA3-200]
|
||||
_ = x[SHA512-201]
|
||||
_ = x[SM3-202]
|
||||
_ = x[SM4-203]
|
||||
_ = x[SVE-204]
|
||||
_ = x[lastID-205]
|
||||
_ = x[TDX_GUEST-159]
|
||||
_ = x[TLB_FLUSH_NESTED-160]
|
||||
_ = x[TME-161]
|
||||
_ = x[TOPEXT-162]
|
||||
_ = x[TSCRATEMSR-163]
|
||||
_ = x[TSXLDTRK-164]
|
||||
_ = x[VAES-165]
|
||||
_ = x[VMCBCLEAN-166]
|
||||
_ = x[VMPL-167]
|
||||
_ = x[VMSA_REGPROT-168]
|
||||
_ = x[VMX-169]
|
||||
_ = x[VPCLMULQDQ-170]
|
||||
_ = x[VTE-171]
|
||||
_ = x[WAITPKG-172]
|
||||
_ = x[WBNOINVD-173]
|
||||
_ = x[WRMSRNS-174]
|
||||
_ = x[X87-175]
|
||||
_ = x[XGETBV1-176]
|
||||
_ = x[XOP-177]
|
||||
_ = x[XSAVE-178]
|
||||
_ = x[XSAVEC-179]
|
||||
_ = x[XSAVEOPT-180]
|
||||
_ = x[XSAVES-181]
|
||||
_ = x[AESARM-182]
|
||||
_ = x[ARMCPUID-183]
|
||||
_ = x[ASIMD-184]
|
||||
_ = x[ASIMDDP-185]
|
||||
_ = x[ASIMDHP-186]
|
||||
_ = x[ASIMDRDM-187]
|
||||
_ = x[ATOMICS-188]
|
||||
_ = x[CRC32-189]
|
||||
_ = x[DCPOP-190]
|
||||
_ = x[EVTSTRM-191]
|
||||
_ = x[FCMA-192]
|
||||
_ = x[FP-193]
|
||||
_ = x[FPHP-194]
|
||||
_ = x[GPA-195]
|
||||
_ = x[JSCVT-196]
|
||||
_ = x[LRCPC-197]
|
||||
_ = x[PMULL-198]
|
||||
_ = x[SHA1-199]
|
||||
_ = x[SHA2-200]
|
||||
_ = x[SHA3-201]
|
||||
_ = x[SHA512-202]
|
||||
_ = x[SM3-203]
|
||||
_ = x[SM4-204]
|
||||
_ = x[SVE-205]
|
||||
_ = x[lastID-206]
|
||||
_ = x[firstID-0]
|
||||
}
|
||||
|
||||
const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
|
||||
const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
|
||||
|
||||
var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 65, 69, 79, 91, 99, 107, 115, 123, 130, 140, 150, 158, 168, 179, 187, 197, 215, 230, 237, 249, 256, 263, 274, 282, 286, 290, 296, 301, 309, 314, 320, 324, 333, 351, 359, 366, 370, 374, 388, 394, 398, 402, 411, 415, 419, 424, 429, 433, 437, 444, 448, 451, 457, 460, 463, 473, 483, 496, 509, 513, 517, 531, 548, 551, 561, 572, 578, 586, 597, 605, 617, 633, 647, 658, 668, 683, 691, 702, 712, 719, 723, 726, 733, 738, 749, 756, 763, 771, 774, 780, 785, 794, 801, 809, 813, 816, 822, 829, 842, 847, 849, 856, 863, 869, 873, 882, 886, 891, 897, 903, 909, 919, 922, 938, 947, 950, 959, 974, 987, 993, 1007, 1014, 1017, 1022, 1025, 1028, 1040, 1054, 1064, 1067, 1071, 1075, 1079, 1084, 1089, 1094, 1099, 1113, 1124, 1130, 1133, 1138, 1147, 1151, 1156, 1161, 1167, 1174, 1179, 1182, 1198, 1201, 1207, 1217, 1225, 1229, 1238, 1242, 1254, 1257, 1267, 1270, 1277, 1285, 1292, 1295, 1302, 1305, 1310, 1316, 1324, 1330, 1336, 1344, 1349, 1356, 1363, 1371, 1378, 1383, 1388, 1395, 1399, 1401, 1405, 1408, 1413, 1418, 1423, 1427, 1431, 1435, 1441, 1444, 1447, 1450, 1456}
|
||||
var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 65, 69, 79, 91, 99, 107, 115, 123, 130, 140, 150, 158, 168, 179, 187, 197, 215, 230, 237, 249, 256, 263, 274, 282, 286, 290, 296, 301, 309, 314, 320, 324, 333, 351, 359, 366, 370, 374, 388, 394, 398, 402, 411, 415, 419, 424, 429, 433, 437, 444, 448, 451, 457, 460, 463, 473, 483, 496, 509, 513, 517, 531, 548, 551, 561, 572, 578, 586, 597, 605, 617, 633, 647, 658, 668, 683, 691, 702, 712, 719, 723, 726, 733, 738, 749, 756, 763, 771, 774, 780, 785, 794, 801, 809, 813, 816, 822, 829, 842, 847, 849, 856, 863, 869, 873, 882, 886, 891, 897, 903, 909, 919, 922, 938, 947, 950, 959, 974, 987, 993, 1007, 1014, 1017, 1022, 1025, 1028, 1040, 1054, 1064, 1067, 1071, 1075, 1079, 1084, 1089, 1094, 1099, 1113, 1124, 1130, 1133, 1138, 1147, 1151, 1156, 1161, 1167, 1174, 1179, 1182, 1191, 1207, 1210, 1216, 1226, 1234, 1238, 1247, 1251, 1263, 1266, 1276, 1279, 1286, 1294, 1301, 1304, 1311, 1314, 1319, 1325, 1333, 1339, 1345, 1353, 1358, 1365, 1372, 1380, 1387, 1392, 1397, 1404, 1408, 1410, 1414, 1417, 1422, 1427, 1432, 1436, 1440, 1444, 1450, 1453, 1456, 1459, 1465}
|
||||
|
||||
func (i FeatureID) String() string {
|
||||
if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) {
|
||||
|
|
|
|||
Loading…
Add table
Add a link
Reference in a new issue